PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01422g01034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 266aa    MW: 29418 Da    PI: 8.9295
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01422g01034.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.35e-19175209135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++C ++kTp+WR+gp g+ktLCnaCG++yr+ +l
  Niben101Scf01422g01034.1 175 CTHCEVKKTPQWREGPLGPKTLCNACGVRYRSGRL 209
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011410.963169205IPR000679Zinc finger, GATA-type
SMARTSM004015.2E-15169223IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-14169231No hitNo description
Gene3DG3DSA:3.30.50.109.9E-14174206IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.48E-15174221No hitNo description
PROSITE patternPS003440175200IPR000679Zinc finger, GATA-type
PfamPF003207.2E-17175209IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MVEQNCWDYI PMGPIVHEDF ESLLNSLDFP LESLEEDGLG RDWDPSLYQL LGPIPADALP  60
PVSRGDNANG CLNAANELPE AQGTVPFQAH SPISVLEHNS SCSGGQSTFS NFGTKGRRSK  120
RARPSTLNPW ILMAPTSCTA FASKKNSDAK KGKEKKRRKL SQQSSVMESS LFKKCTHCEV  180
KKTPQWREGP LGPKTLCNAC GVRYRSGRLL PEYRPAASPT FVPSLHSNSH RKVVEMRRNA  240
VEESQGDLLE TKRSFTKPSN ATEPKX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154158KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774660.11e-158PREDICTED: GATA transcription factor 11-like
RefseqXP_016486021.11e-158PREDICTED: GATA transcription factor 11-like
TrEMBLK4C9N01e-109K4C9N0_SOLLC; Uncharacterized protein
STRINGSolyc06g075140.2.11e-108(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31342149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.27e-51GATA transcription factor 11